HORDB

ID: hor006316
Uniprot ID: Q8WXF3
Protein name: Relaxin-3 B chain
Gene name: RLN3
Organism: Homo sapiens (Human)
Family: Insulin family
Source: Human
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: RAAPYGVRLCGREFIRAVIFTCGGSRW
Length: 27
Propeptide: MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
Signal peptide: MARYMLLLLLAVWVLTGELWPGAEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May play a role in neuropeptide signaling processes. Ligand for LGR7, RXFP3 and RXFP4.
Mechanism: NA
Cross BBB: NA
Target: RXFP3
Target Unid: Q9NSD7
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

2fhw.pdb

hor006316_AF2.pdb

hor006316_ESM.pdb

Mass:	350651	Formula:	C136H213N43O33S2
Absent amino acids:	DHKMNQ	Common amino acids:	R
pI:	10.95	Basic residues:	5
Polar residues:	9	Hydrophobic residues:	11
Hydrophobicity:	15.93	Boman Index:	-4464
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	75.93
Instability Index:	4653.7	Extinction Coefficient cystines:	7115
Absorbance 280nm:	273.65

PubMed ID: 12686464
Title: Production of recombinant human relaxin 3 in AtT20 cells.
PubMed ID: 12975309
Title: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
PubMed ID: 12506116
Title: H3 relaxin is a specific ligand for LGR7 and activates the receptor by interacting with both the ectodomain and the exoloop 2.
PubMed ID: 14522968
Title: Identification of relaxin-3/INSL7 as an endogenous ligand for the orphan G-protein-coupled receptor GPCR135.
PubMed ID: 14522967
Title: Identification of relaxin-3/INSL7 as a ligand for GPCR142.
PubMed ID: 16365033
Title: Solution structure and novel insights into the determinants of the receptor specificity of human relaxin-3.